Dst5 : HugeDomains.com

Dst5.com open link

Dst5.com Daily Stats
Daily Unique Visitors   Daily Unique Visitors 1,183
Daily Pageviews   Daily Pageviews 3,548
Daily  Revenue   Daily Revenue $ 10.64
Dst5.com Monthly Stats
Estimated Monthly Stats   Monthly Unique Visitors 34,929
Monthly Pageviews   Monthly Pageviews 104,772
Monthly  Revenue   Monthly Revenue $ 314.32
Dst5.com Yearly Stats
Yearly Unique Visitors   Yearly Unique Visitors 432,017
Yearly Pageviews   Yearly Pageviews 1,295,880
yearly  Revenue   Yearly Revenue $ 3,887.64

Dst5.com or simply erothots receives roughly 3,548 pageviews (page impressions) daily from it's 1,183 unique daily visitor. Dst5.com was created 5 years, 6 months, 12 days ago and it's hosted on the IP Address Unknown in Unknown, XX. It has an estimated worth of $ 2,285.22 and a global Alexa rank of 3,518,513.

Updated 3 months ago

Update Now!

Dst5.com Basic information

Domain name Dst5.com
Title

HugeDomains.com

Keywords

Description

Dst5.com Location Stats

IP Address Unknown
Country XX XX
Region Unknown
City Unknown

Dst5.com Header

  Dst5.com DNS Records

  Dst5.com SSL Certificate

  Dst5.com WHOIS

Domain Name: DST5.COM
Registry Domain ID: 2526607463_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namebright.com
Registrar URL: http://www.NameBright.com
Updated Date: 2025-05-16T07:40:41Z
Creation Date: 2020-05-15T19:11:19Z
Registry Expiry Date: 2026-05-15T19:11:19Z
Registrar: TurnCommerce, Inc. DBA NameBright.com
Registrar IANA ID: 1441
Registrar Abuse Contact Email: support@namebright.com
Registrar Abuse Contact Phone: 17204960020
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NSG1.NAMEBRIGHTDNS.COM
Name Server: NSG2.NAMEBRIGHTDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2025-08-19T07:38:01Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  Typos of Dst5.com

www.st5.comwww.fst5.com
www.dt5.comwww.cst5.com
www.ds5.comwww.xst5.com
www.dst.comwww.dat5.com
www.ddst5.comwww.dwt5.com
www.dsst5.comwww.det5.com
www.dstt5.comwww.ddt5.com
www.dst55.comwww.dxt5.com
www.sdt5.comwww.dzt5.com
www.dts5.comwww.dsr5.com
www.ds5t.comwww.dsf5.com
www.sst5.comwww.dsg5.com
www.est5.comwww.dsy5.com
www.rst5.com

Recently Viewed Websites

WebsiteLast Visit
uglyuglychristmas.com2 Sec ago
lite8.com2 Sec ago
markdavidrogers.com4 Sec ago
shrktalamraldwlyhlmkafhtalhshrgmail.wordpress.com7 Sec ago
sharadaeducation.com9 Sec ago